PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P24310_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 535aa    MW: 59672 Da    PI: 6.5133
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P24310_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.33.7e-1251665342373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL++cAe +s+++ ++ + l+++ +  +s +g p+qRl ay++e+L ar  +s++++ +al+++e +   s+e l++++++++++P
  GSMUA_Achr6P24310_001 166 KQLLIKCAETLSKNKIKEFELLVEKARSVVSITGVPIQRLGAYMLEGLVARHKSSGTNIHRALRCREPE---SKELLSYMRILYDICP 250
                            689*****************************************************************9...9*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            ++kf++++aN aI +a+++e+r+HiiDf+i qG+ W++L+qaLa+Rp+gpp++RiTg+++p ++  + + l+ +g+ L ++ +++++p
  GSMUA_Achr6P24310_001 251 YFKFGYMAANGAIADALKKEDRIHIIDFQIAQGTRWVTLIQALAARPGGPPHVRITGIDDPVAEytRGDGLHVVGKMLLDMSKKFNIP 338
                            ************************************************************9998999********************* PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                            +ef+ l      +++ e+L+v+ gEalaVn+ lqlh+++des +++++ d +L+lvkslsPkv+++veqe+++n+++F  rf+e+l+y
  GSMUA_Achr6P24310_001 339 LEFKGL-PVCEPEVTKEMLDVRLGEALAVNFTLQLHHTPDESDDVNNPGDGLLRLVKSLSPKVMTLVEQESNTNTTPFSSRFVETLDY 425
                            *****7.56668899************************************************************************* PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                            ysa+f+s+++ lp+es++ri+vE+++l+++ivn++aceg++r+erhe l+kWr+rl++aGF+p+pls ++++ +k+ll  ++ d y++
  GSMUA_Achr6P24310_001 426 YSAMFESVDVMLPKESKDRINVEQHCLAKDIVNIIACEGKDRIERHELLSKWRSRLSMAGFRPYPLSPYVNSVIKTLLGYYS-DKYTL 512
                            ******************************************************************************9999.55*** PP

                   GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
                             e++g+l+lgWk+r+Lvs+SaW
  GSMUA_Achr6P24310_001 513 MEKDGALLLGWKNRNLVSASAW 534
                            ********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.844139516IPR005202Transcription factor GRAS
PfamPF035141.3E-122166534IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MDSHQLYGLT GANLSCEHPS PRNLVLIEWT LDSTKSALGN SPSSPLSSQF ECDNLSVPSN  60
IQDQHSSTDT IPGVSLSGYS PLDTDSRFKP SQVHLPEGIQ IQSNSLSAAS SQSMKHALQE  120
IETALMAPDT DEPTTSTDPE NLNPSHEVRP EKRLREMRKP SGNDVKQLLI KCAETLSKNK  180
IKEFELLVEK ARSVVSITGV PIQRLGAYML EGLVARHKSS GTNIHRALRC REPESKELLS  240
YMRILYDICP YFKFGYMAAN GAIADALKKE DRIHIIDFQI AQGTRWVTLI QALAARPGGP  300
PHVRITGIDD PVAEYTRGDG LHVVGKMLLD MSKKFNIPLE FKGLPVCEPE VTKEMLDVRL  360
GEALAVNFTL QLHHTPDESD DVNNPGDGLL RLVKSLSPKV MTLVEQESNT NTTPFSSRFV  420
ETLDYYSAMF ESVDVMLPKE SKDRINVEQH CLAKDIVNII ACEGKDRIER HELLSKWRSR  480
LSMAGFRPYP LSPYVNSVIK TLLGYYSDKY TLMEKDGALL LGWKNRNLVS ASAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-621655354375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009405929.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1-like
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM0T9S70.0M0T9S7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P24310_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106313643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-178GRAS family protein